PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv3_060000_xtmt.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 358aa    MW: 38905.8 Da    PI: 6.6339
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv3_060000_xtmt.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.35.4e-18180234256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Bv3_060000_xtmt.t1 180 RKKLRLSKEQSAFLEESFKEHHTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 234
                         778899***********************************************98 PP

2HD-ZIP_I/II127.55.7e-41180270192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +l
  Bv3_060000_xtmt.t1 180 RKKLRLSKEQSAFLEESFKEHHTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR-AL 269
                         69*************************************************************************************9.55 PP

         HD-ZIP_I/II  92 k 92 
                         k
  Bv3_060000_xtmt.t1 270 K 270
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-17164234IPR009057Homeodomain-like
SuperFamilySSF466896.42E-19171237IPR009057Homeodomain-like
PROSITE profilePS5007117.216176236IPR001356Homeobox domain
SMARTSM003892.1E-16178240IPR001356Homeobox domain
CDDcd000862.09E-16180237No hitNo description
PfamPF000462.0E-15180234IPR001356Homeobox domain
PROSITE patternPS000270211234IPR017970Homeobox, conserved site
SMARTSM003403.7E-25236279IPR003106Leucine zipper, homeobox-associated
PfamPF021837.4E-11236270IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGLTSSSSNK STAEKEDENM KDDDHHHQER RDNVGSSSSS DPSPLQLDLL PFSPLPRSTQ  60
PPPPLRFPWL TDNLSSEPGS SDGPGPKINE VNRRAAVGPA TEEVDEHSSP NSGTSSFMEF  120
SLYTSNNNNN SGGERKSGRR ENGNNYGQEI IGIVGGGGDE GERGATTSRG SDDEENGSTR  180
KKLRLSKEQS AFLEESFKEH HTLNPKQKLA LAKQLNLRPR QVEVWFQNRR ARTKLKQTEV  240
DCEYLKRCCE TLTEENRRLQ KELQELRALK TSQPYFMQLP ATTLTMCPSC ERVAPTSTST  300
VVAASSAPAT PSTSSAVTVA ANGTAVASGS TNDITLSLGK PKVSMLPFSN VQAHQAAS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1178184TRKKLRL
2228236RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010672636.10.0PREDICTED: homeobox-leucine zipper protein HOX11
SwissprotP466651e-81HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A0J8FHB60.0A0A0J8FHB6_BETVU; Uncharacterized protein
STRINGPOPTR_0016s05890.11e-108(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-64homeobox from Arabidopsis thaliana